HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVK7

Names and origin
Entry : E3GVK7 (unreviewed)
Entry name : E3GVK7_HAEI2
Protein names : Heme export ABC transporter, ATP-binding component
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ccmA
ORF names : R2846_1249
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity; cytochrome complex assembly; outer membrane-bounded periplasmic space; plasma membrane; transporter activity
GO identifier : GO:0005524; GO:0006200; GO:0016887; GO:0017004; GO:0030288; GO:0005886; GO:0005215
Keywords
Ligand & Biological process : ATP-binding; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Hydrolase; Membrane; Nucleotide-binding; Transport
General annotation
Domains : ABC transporter domain (1)
Sequence similarities : Belongs to ABC transporter superfamily
Protein sequence
Length : 228 residues
>E3GVK7|E3GVK7_HAEI2 Haemophilus influenzae R2846
MFEQHKLSLQNLSCQRGERVLFRALTCDFNSGDFVQIEGHNGIGKTSLLRILAGLAQPLE
GEVRWDAEAISKQREQYHQNLLYLGHLLGVKPELTAWENLQFYQRISQAEQNTDMLWDLL
EKVGLLGREDLPAAQLSAGQQKRIALGRLWLSQAPLWILDEPFTAIDKKGVEILTALFDE
HAQRGGIVLLTSHQEVPSSHLQKLNLAAYKAE