HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVK4

Names and origin
Entry : E3GVK4 (unreviewed)
Entry name : E3GVK4_HAEI2
Protein names : Heme export ABC transporter, CcmD component
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ccmD
ORF names : R2846_1246
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cytochrome complex assembly; heme transport; integral to membrane
GO identifier : GO:0017004; GO:0015886; GO:0016021
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 75 residues
>E3GVK4|E3GVK4_HAEI2 Haemophilus influenzae R2846
MFFQTWSDFFNMGGYGFYVWLSYAVSLVAVIALIVQSVKQRKTVLQNVLREQQREERLQQ
ANKGNTL