HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVE5

Names and origin
Entry : E3GVE5 (unreviewed)
Entry name : E3GVE5_HAEI2
Protein names : Anaerobic ribonucleoside-triphosphate reductase-activating protein (EC 1.97.1.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : nrdG
ORF names : R2846_1187
EC number : 1.97.1.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 4 iron, 4 sulfur cluster binding; [formate-C-acetyltransferase]-activating enzyme activity; cytoplasm
GO identifier : GO:0051539; GO:0043365; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Oxidoreductase
General annotation
Sequence similarities : Belongs to Organic radical-activating enzymes family
Protein sequence
Length : 167 residues
>E3GVE5|E3GVE5_HAEI2 Haemophilus influenzae R2846
MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDDVMEQQIINDLK
DTRIKRQGLTLSGGDPLHPRNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDEQQRAML
PYIDVLIDGKFIQEQADPSLVWRGSANQIIHRFKL