HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GVD6

Names and origin

Entry	:	E3GVD6 (unreviewed)
Entry name	:	E3GVD6_HAEI2
Protein names	:	Glutaredoxin
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	grxD
ORF names	:	R2846_1177

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

Keywords

Ligand & Biological process

Complete proteome

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

115 residues

>E3GVD6|E3GVD6_HAEI2 Haemophilus influenzae R2846
METLDKIKKQISENPILIYMKGSPKFPSCGFSARASEALMNCKVPFGYVDILQHPDIRAE
LPTYANWPTFPQLWVEGELVGGCDIILEMYQAGELQTLLAEVAAKHA