HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVC8

Names and origin
Entry : E3GVC8 (unreviewed)
Entry name : E3GVC8_HAEI2
Protein names : Protein SprT
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : sprT
ORF names : R2846_1169
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; zinc ion binding
GO identifier : GO:0005737; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Metal-binding; Zinc
General annotation
Domains : SprT-like domain (1)
Sequence similarities : Belongs to SprT family
Subcellular location : Cytoplasm.
Protein sequence
Length : 168 residues
>E3GVC8|E3GVC8_HAEI2 Haemophilus influenzae R2846
MQRKLNQSLLLAEAYFKRKFTMPEVNYELRGIKAGVAYLQKNEIKFNRTLLQENTDEFIR
QVVPHELAHLIVYQMFGRVKPHGKEWQLVMNEIFKLPADTCHQFDIKNVQGKTFEYRCAC
QTHFLTIRRHNKIMKENIEYLCKKCKGKLVFVDDEE