HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVB3

Names and origin
Entry : E3GVB3 (unreviewed)
Entry name : E3GVB3_HAEI2
Protein names : 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : queD
ORF names : R2846_1154
EC number : 4.-.-.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : lyase activity; metal ion binding; queuosine biosynthetic process
GO identifier : GO:0016829; GO:0046872; GO:0008616
Keywords
Ligand & Biological process : Complete proteome; Lyase; Metal-binding; Queuosine biosynthesis; Zinc
General annotation
Pathway : Purine metabolism; 7-cyano-7-deazaguanine biosynthesis.
Sequence similarities : Belongs to PTPS family, QueD subfamily
Protein sequence
Length : 153 residues
>E3GVB3|E3GVB3_HAEI2 Haemophilus influenzae R2846
MFKISKEFSFDMAHLLDGHDGKCQNLHGHTYKLQVEISGDLYESGAKKAMVIDFSDLKSI
VKKVILDPMDHAFIYDQTNERESQIATLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHDE
QLSISSIRLWETPTSFCEYQE