HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GV99

Names and origin
Entry : E3GV99 (unreviewed)
Entry name : E3GV99_HAEI2
Protein names : UPF0208 membrane protein R2846_1139
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yfbV
ORF names : R2846_1139
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane
GO identifier : GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to UPF0208 family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 159 residues
>E3GV99|E3GV99_HAEI2 Haemophilus influenzae R2846
MAFFSIFKQGQIYLNTWPLEAKLGIIFPENRIMKATSFAQKFMPFVAVFAILWQQFYAKN
DLMAFSIAILTALFALLIPFQGLYWLGKRANTPLENQSAVWFYDICERLKQLHEPLPFVQ
EKPTYQHLAEVLKKAQSKLERAFWQEI