HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GV69

Names and origin
Entry : E3GV69 (unreviewed)
Entry name : E3GV69_HAEI2
Protein names : 50S ribosomal protein L25
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL25
ORF names : rplY
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 5S rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0008097; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L25P family
Protein sequence
Length : 103 residues
>E3GV69|E3GV69_HAEI2 Haemophilus influenzae R2846
MAFKFNAEVRTAQGKGASRRLRHNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSE
VITLVIGGKEVAVKVQAMQRHPFKPKLVHIDFKRA