HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GV47

Names and origin
Entry : E3GV47 (unreviewed)
Entry name : E3GV47_HAEI2
Protein names : Outer-membrane lipoprotein LolB
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : lolB
ORF names : R2846_1083
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell outer membrane; plasma membrane; protein transporter activity
GO identifier : GO:0009279; GO:0005886; GO:0008565
Keywords
Ligand & Biological process : Cell membrane; Cell outer membrane; Chaperone; Complete proteome; Lipoprotein; Membrane; Palmitate; Protein transport; Signal; Transport
General annotation
Sequence similarities : Belongs to LolB family
Subcellular location : Cell outer membrane; Lipid-anchor.
Protein sequence
Length : 225 residues
>E3GV47|E3GV47_HAEI2 Haemophilus influenzae R2846
MNNMKTFKFFTALFATAILTACTLDMERPTNVQYIDKTDVIWQQHLQKIQKIQSYQAKGQ
IGYISPTERFSSHFEWQYQNPKSYTLKLYSLISKSTLLIQMHQSGMTISDNNGNQQSAAN
AKQLLQEIIGMDIPLEHLVYWLKGQPAMNADYQVGTNHLLGAFTYHVDGSQWTADYLTYH
SNNSMPENILLKNDSTKQTLKIRVVEWIY