HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GV33

Names and origin
Entry : E3GV33 (unreviewed)
Entry name : E3GV33_HAEI2
Protein names : Leucine responsive regulatory protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : lrp
ORF names : R2846_1069
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : intracellular; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005622; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Transcription; Transcription regulation
General annotation
Domains : HTH asnC-type DNA-binding domains (3)
Protein sequence
Length : 178 residues
>E3GV33|E3GV33_HAEI2 Haemophilus influenzae R2846
MCKEIKKMEKKRNKALDAIDIKILNELQRNGKISNIDLSRKVGLSPTPCLERVKRLEKQG
VIMGYRALLNPELLDAPLLVIVEITLVRGKPDVFEEFNAAIQELDEIQECHLVSGDFDYL
LKTRVADMAEYRKLLGTTLLRLPGVNDTRTYVVMEEVKQTNFLVLK