HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUX2

Names and origin
Entry : E3GUX2 (unreviewed)
Entry name : E3GUX2_HAEI2
Protein names : Glutaredoxin 1
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : grxA
ORF names : R2846_1007
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0015035
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 95 residues
>E3GUX2|E3GUX2_HAEI2 Haemophilus influenzae R2846
MFVVIFGRPGCPYCVRAKNLAEKLKGEVADFGYRYVDIHAEGITKEDLSKSVGKPVETVP
QIFIDEKPIGGCTDFEALMKEQFGIVA