HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUV0

Names and origin
Entry : E3GUV0 (unreviewed)
Entry name : E3GUV0_HAEI2
Protein names : N utilization substance protein B homolog (Protein NusB)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : nusB
ORF names : R2846_0981
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA-dependent transcription, termination; RNA binding; regulation of transcription, DNA-dependent
GO identifier : GO:0006353; GO:0003723; GO:0006355
Keywords
Ligand & Biological process : Complete proteome; Transcription; Transcription regulation; Transcription termination
General annotation
Sequence similarities : Belongs to NusB family
Protein sequence
Length : 156 residues
>E3GUV0|E3GUV0_HAEI2 Haemophilus influenzae R2846
MTEQKQVKKPSARRRARECTVQALYSWAVSGNTAEQVELAFVLDQDMDGVDKPYFRKLFR
QTIENIETVDFSISPYIDRTFDELDPIETAILRLAVYELRFELDVPYKVVINEAIEVAKV
FGADESHKYINGVLDKIAPALGRK