HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUU5

Names and origin
Entry : E3GUU5 (unreviewed)
Entry name : E3GUU5_HAEI2
Protein names : Flavodoxin NrdI
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : nrdI
ORF names : R2846_0976
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : 2Fe-2S; Complete proteome; Iron; Iron-sulfur; Metal-binding
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1)
Protein sequence
Length : 90 residues
>E3GUU5|E3GUU5_HAEI2 Haemophilus influenzae R2846
MKIHLIRHNTTLEFNNETSLLDHLEKNNIHHEYQCRSGYCGSCRVKIKKGKVSYKEMPLA
FIQPDEILLCCCHVESDLEIDL