HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GUU1

Names and origin

Entry	:	E3GUU1 (unreviewed)
Entry name	:	E3GUU1_HAEI2
Protein names	:	Integration host factor subunit alpha (IHF-alpha)
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	ihfA
ORF names	:	himA

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	DNA binding; DNA recombination; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier	:	GO:0003677; GO:0006310; GO:0006355; GO:0006417; GO:0006351

Keywords

Ligand & Biological process

Complete proteome; DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation

General annotation

Sequence similarities

Belongs to Bacterial histone-like protein family

Protein sequence

Length

104 residues

>E3GUU1|E3GUU1_HAEI2 Haemophilus influenzae R2846
MATITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDVKLSGFGNFELRDKSS
RPGRNPKTGDVVPVSARRVVTFKPGQKLRARVEKTK