HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUS7

Names and origin
Entry : E3GUS7 (unreviewed)
Entry name : E3GUS7_HAEI2
Protein names : Translation initiation factor IF-3
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : infC
ORF names : R2846_0957
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Sequence similarities : Belongs to IF-3 family
Subcellular location : Cytoplasm.
Protein sequence
Length : 192 residues
>E3GUS7|E3GUS7_HAEI2 Haemophilus influenzae R2846
MKTVKKAPAVNRPNRINEEIRVKEVRLIDQNGEQAGIVSIQQALEMAEQAELDLVEISPN
AEPPVCRIMNYGKFLYEKSKTAKEQKKKQKVVQVKEIKFRPGTDEGDYQVKLRSLIRFLE
DGDKAKITVRFRGREMAHQDIGLDVLERVKNDLAEISVVESAPGKLEGRQAVMVLAPKKK