HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUS2

Names and origin
Entry : E3GUS2 (unreviewed)
Entry name : E3GUS2_HAEI2
Protein names : Macrodomain Ter protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ycbG
ORF names : matP
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell cycle; cell division; cytoplasm; sequence-specific DNA binding
GO identifier : GO:0007049; GO:0051301; GO:0005737; GO:0043565
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; DNA-binding
General annotation
Sequence similarities : Belongs to MatP family
Subcellular location : Cytoplasm.
Protein sequence
Length : 160 residues
>E3GUS2|E3GUS2_HAEI2 Haemophilus influenzae R2846
MKYQKLENQESNWKWIYLIRKHREGENITRYEERSLQEAKAQELLESQNYPSQIEEWIKN
HLSPALPIKLDQAIRARRKRFFNGEKQHTKKKSIDLEYAVWLRLSKYSRKMKMTLSETIT
YMIDERESKAQFENQMAAMKTSLKNLLK