HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUR5

Names and origin
Entry : E3GUR5 (unreviewed)
Entry name : E3GUR5_HAEI2
Protein names : Transcription elongation factor GreA (Transcript cleavage factor GreA)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : greA
ORF names : greA1
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of DNA-dependent transcription, elongation; transcription, DNA-dependent; translation elongation factor activity
GO identifier : GO:0003677; GO:0032784; GO:0006351; GO:0003746
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Elongation factor; Protein biosynthesis; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to GreA/GreB family
Protein sequence
Length : 170 residues
>E3GUR5|E3GUR5_HAEI2 Haemophilus influenzae R2846
MQQIPMTVRGAEQLREELDFLKNVRRPEIIKAIAEAREHGDLKENAEYHAAREQQGFCEG
RIQEIEGKLGNAQIIDVTKMPNNGKVIFGATVVLVNTNTDEEVTYRIVGDDEADIKSGLI
SVNSPIARGLIGKELDDTVNITTPGGVVEFDIIEVNYI