HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUR4

Names and origin
Entry : E3GUR4 (unreviewed)
Entry name : E3GUR4_HAEI2
Protein names : RNA-binding protein YhbY
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yhbY
ORF names : R2846_0944
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : RNA binding
GO identifier : GO:0003723
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 107 residues
>E3GUR4|E3GUR4_HAEI2 Haemophilus influenzae R2846
MTTLSTKQKQFLKGLAHHLNPVVMLGGNGLTEGVLAEIENALNHHELIKVKVAGADRETK
QLIINAIVRETKAAQVQTIGHILVLYRPSEEAKIQLPRK