HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUQ0

Names and origin
Entry : E3GUQ0 (unreviewed)
Entry name : E3GUQ0_HAEI2
Protein names : UPF0263 protein R2846_0930
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yciU
ORF names : R2846_0930
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0263 family
Protein sequence
Length : 115 residues
>E3GUQ0|E3GUQ0_HAEI2 Haemophilus influenzae R2846
MTTEIKKLDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADNWEEEI
GVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDCEFHVIWKK