HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUN7

Names and origin
Entry : E3GUN7 (unreviewed)
Entry name : E3GUN7_HAEI2
Protein names : Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : xseB
ORF names : R2846_0917
EC number : 3.1.11.6
History
Date of creation : 2011-01-11
Date of modification : 2013-12-11
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA catabolic process; cytoplasm; exodeoxyribonuclease VII activity; exodeoxyribonuclease VII complex; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0006308; GO:0005737; GO:0008855; GO:0009318; GO:0090305
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Exonuclease; Hydrolase; Nuclease
General annotation
Sequence similarities : Belongs to XseB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 87 residues
>E3GUN7|E3GUN7_HAEI2 Haemophilus influenzae R2846
MARKPASSQDFETTLAQLENIVTHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAEQRI
QILLQKTEDAPLNDYKGNA