HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUN3

Names and origin
Entry : E3GUN3 (unreviewed)
Entry name : E3GUN3_HAEI2
Protein names : UPF0181 protein R2846_0913
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yoaH
ORF names : R2846_0913
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0181 family
Protein sequence
Length : 56 residues
>E3GUN3|E3GUN3_HAEI2 Haemophilus influenzae R2846
MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKNDKKTPEN