HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUN2

Names and origin
Entry : E3GUN2 (unreviewed)
Entry name : E3GUN2_HAEI2
Protein names : Cold shock protein CspD
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : cspD
ORF names : R2846_0912
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003677; GO:0005737; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Domains : CSD (cold-shock) domain (1)
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E3GUN2|E3GUN2_HAEI2 Haemophilus influenzae R2846
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHSDKGSH
ATKIIPIADTQE