HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUN1

Names and origin
Entry : E3GUN1 (unreviewed)
Entry name : E3GUN1_HAEI2
Protein names : Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ybaK
ORF names : R2846_0911
EC number : 4.2.-.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : aminoacyl-tRNA editing activity; cytoplasm; ligase activity; lyase activity; regulation of translational fidelity; translation
GO identifier : GO:0002161; GO:0005737; GO:0016874; GO:0016829; GO:0006450; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Ligase; Lyase; Protein biosynthesis
General annotation
Sequence similarities : Belongs to Prolyl-tRNA editing family, YbaK/EbsC subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 170 residues
>E3GUN1|E3GUN1_HAEI2 Haemophilus influenzae R2846
MTPAIDLLKKQKIPFILHTYDHDPNNQHFGDEAAEKLGIDPNRSFKTLLVAENGDQKKLA
CFVLATANMLNLKKAAKSIGVKKVEMADKDAAQKSTGYLVGGISPLGQKKRVKTVINSTA
LEFETIYVSGGKRGLSVEIAPQDLAKVLGAEFTDIVDE