HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUK8

Names and origin
Entry : E3GUK8 (unreviewed)
Entry name : E3GUK8_HAEI2
Protein names : Putative uncharacterized protein ycfA1
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ycfA1
ORF names : R2846_0887
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : hydrolase activity, acting on ester bonds; mRNA binding
GO identifier : GO:0016788; GO:0003729
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 64 residues
>E3GUK8|E3GUK8_HAEI2 Haemophilus influenzae R2846
MHSGDLIKELKANGCYFVRHGKGDHQIWFSPKTGKRFPVPHPKQDLAIGTLKSIKKSAGL