HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUK0

Names and origin
Entry : E3GUK0 (unreviewed)
Entry name : E3GUK0_HAEI2
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
ORF names : R2846_0879
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 61 residues
>E3GUK0|E3GUK0_HAEI2 Haemophilus influenzae R2846
MFVTSLLPASYTGVETVTKLAGQTAHLLNSIPLDEEDTRLAFDVYPHQTPCLSNQLQ