HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUJ6

Names and origin
Entry : E3GUJ6 (unreviewed)
Entry name : E3GUJ6_HAEI2
Protein names : UPF0267 protein R2846_0875
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yqfB
ORF names : R2846_0875
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0267 family
Protein sequence
Length : 112 residues
>E3GUJ6|E3GUJ6_HAEI2 Haemophilus influenzae R2846
MQPNDITFYQRFEADILAGRKTITIRDKSESYFKAGDILRVGRFEDNQYFCTIEVLSVSP
ITLDELTEQHAKQENMGLAELREVIKTIYPNESEFWVIEIRLVN