HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUH2

Names and origin
Entry : E3GUH2 (unreviewed)
Entry name : E3GUH2_HAEI2
Protein names : Sulfurtransferase (EC 2.8.1.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : tusE
ORF names : R2846_0850
EC number : 2.8.1.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : transferase activity
GO identifier : GO:0016740
Keywords
Ligand & Biological process : Complete proteome; Transferase
General annotation
Sequence similarities : Belongs to DsrC/tusE family
Protein sequence
Length : 119 residues
>E3GUH2|E3GUH2_HAEI2 Haemophilus influenzae R2846
MLNINGIGIEVETDKDGYLLHSQQWNEDVAQAIAQLENIELTDAHWEVIYFVRNFYQEYN
TSPAIRMLVKAMAEKLGADKGNSRYLQRLFPEGPAKQATKLAGLPKPAKCL