HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUH1

Names and origin
Entry : E3GUH1 (unreviewed)
Entry name : E3GUH1_HAEI2
Protein names : Molybdate-binding protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : mopI
ORF names : R2846_0849
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : ATP binding; ATP-binding cassette (ABC) transporter complex; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; molybdenum ion binding
GO identifier : GO:0005524; GO:0043190; GO:0016820; GO:0030151
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 77 residues
>E3GUH1|E3GUH1_HAEI2 Haemophilus influenzae R2846
MKISARNQLKGKVVSIENGSVNAIVHIDIGGGNVLSSTVSLAAVKELNLEVGKEAYAIIK
ATSVMVGVE