HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUG7

Names and origin
Entry : E3GUG7 (unreviewed)
Entry name : E3GUG7_HAEI2
Protein names : FMN-dependent NADH-azoreductase (EC 1.7.-.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : azoR
ORF names : R2846_0845
EC number : 1.7.-.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : FMN binding; FMN reductase activity; electron carrier activity; oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor; oxidoreductase activity, acting on other nitrogenous compounds as donors
GO identifier : GO:0010181; GO:0008752; GO:0009055; GO:0016652; GO:0016661
Keywords
Ligand & Biological process : Complete proteome; FMN; Flavoprotein; NAD; Oxidoreductase
General annotation
Sequence similarities : Belongs to Azoreductase type 1 family
Protein sequence
Length : 210 residues
>E3GUG7|E3GUG7_HAEI2 Haemophilus influenzae R2846
MNNVLVLKSSISGNNSQTNQLADYVIEKLQGNNIVVRDLSQQPLPYFDTAAAIAVRGEPK
TTEEKQLLALSDKLIEELKNAQTLIIGAPMYNLNVPTQLKSYFDFIARPRVTFQYTANGS
EGLLKGKKAIVLCAFGGLYDEENLVTQYMKSILGFIGITDVQFVYAQGIGFGPEAIEKAQ
ASAKNKINEIVANL