HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUF4

Names and origin
Entry : E3GUF4 (unreviewed)
Entry name : E3GUF4_HAEI2
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
ORF names : R2846_0832
History
Date of creation : 2011-01-11
Date of modification : 2013-09-18
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : outer membrane; pathogenesis
GO identifier : GO:0019867; GO:0009405
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 118 residues
>E3GUF4|E3GUF4_HAEI2 Haemophilus influenzae R2846
MATYRFMVLSNTVKGASSQVFGQGNKVYGVYHTVSGYYNEVGKDSNQVDDNSAVNYTVAL
GYHAKTLGNNAVAIGVGYTPKANITLKSGIAVNAGKNSKISYQMGADWVW