HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUD3

Names and origin
Entry : E3GUD3 (unreviewed)
Entry name : E3GUD3_HAEI2
Protein names : Ribosome-binding factor A
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rbfA
ORF names : R2846_0809
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; rRNA processing
GO identifier : GO:0005737; GO:0006364
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; rRNA processing
General annotation
Sequence similarities : Belongs to RbfA family
Subcellular location : Cytoplasm.
Protein sequence
Length : 140 residues
>E3GUD3|E3GUD3_HAEI2 Haemophilus influenzae R2846
MAREFKRSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHD
ETAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGMRMSNLVTNVVREDE
KKHVEESN