HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUC7

Names and origin
Entry : E3GUC7 (unreviewed)
Entry name : E3GUC7_HAEI2
Protein names : Ribosome maturation factor RimP
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rimP
ORF names : R2846_0802
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; ribosome biogenesis
GO identifier : GO:0005737; GO:0042254
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Ribosome biogenesis
General annotation
Sequence similarities : Belongs to RimP family
Subcellular location : Cytoplasm.
Protein sequence
Length : 163 residues
>E3GUC7|E3GUC7_HAEI2 Haemophilus influenzae R2846
MATLEQNLQEMLQDAVEDLGCELWGIECQRMGRFMTVRLFIDKDGGVTVDDCADVSRQVS
AILDVEDPIADKYNLEVSSPGLDRPLFTLPQFERYIGQDIAVHLRIPVMERRKWQGKLER
IEKDMITLIVDDQEQILVFGNIQKANVVAKF