HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GUA5

Names and origin
Entry : E3GUA5 (unreviewed)
Entry name : E3GUA5_HAEI2
Protein names : Probable toxin-antitoxin locus protein (HigA-family)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : higA
ORF names : R2846_0778
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : sequence-specific DNA binding
GO identifier : GO:0043565
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 115 residues
>E3GUA5|E3GUA5_HAEI2 Haemophilus influenzae R2846
MMTRKPTSVGEILQEEFLEPLSLKISDLAQILDVHRNTASNIVNNSSRITLEMAVKLAKV
FDTTPEFWLNLQTRIDLWDLEHNKRFQQSLANVKPALHRHDTSTFAM