HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GU81

Names and origin
Entry : E3GU81 (unreviewed)
Entry name : E3GU81_HAEI2
Protein names : DNA replication initiation factor Had
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : hda
ORF names : R2846_0753
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication; negative regulation of DNA-dependent DNA replication initiation; nucleoside-triphosphatase activity; nucleotide binding; translation initiation factor activity
GO identifier : GO:0006260; GO:0032297; GO:0017111; GO:0000166; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; DNA replication; Initiation factor; Protein biosynthesis
General annotation
Sequence similarities : Belongs to DnaA family
Protein sequence
Length : 247 residues
>E3GU81|E3GU81_HAEI2 Haemophilus influenzae R2846
MNKQLPLPIHQIDDATLENFYGDNNLLLLDSLRKNSSDLKQPFFYIWGDKGSGKTHLLRA
FSNEYLINQRTAIYVPLSKSQYFSTAVLENLEQQELVCLDDLQSVIGNDEWELAIFDLFN
RIKASGKTLLLISADKSPSALSVKLPDLNSRLTWGEIYQLNSLTDEQKIKVLQLAAYQRG
FQLSDETANFLITRLARDMHTLFEALDLLDKASLQAQRNLTIPFVKKILNL