HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GU80

Names and origin
Entry : E3GU80 (unreviewed)
Entry name : E3GU80_HAEI2
Protein names : Translation initiation factor Sui1
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yciH
ORF names : R2846_0752
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : translation initiation factor activity
GO identifier : GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Initiation factor; Protein biosynthesis
Protein sequence
Length : 114 residues
>E3GU80|E3GU80_HAEI2 Haemophilus influenzae R2846
MSDSVLVYSTDVGRIKEEKASVVRPKGDGVVRIQKQTSGRKGAGVSVITGLDLSDEELKK
LAAELKKRCGCGGAVKNGIIEIQGEKRDLLKQLLEQKGFKVKLLGG