HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GU66

Names and origin

Entry	:	E3GU66 (unreviewed)
Entry name	:	E3GU66_HAEI2
Protein names	:	UPF0102 protein R2846_0737
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	yraN
ORF names	:	R2846_0737

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier	:	GO:0004518; GO:0003676; GO:0090305

Keywords

Ligand & Biological process

Complete proteome

General annotation

Sequence similarities

Belongs to UPF0102 family

Protein sequence

Length

127 residues

>E3GU66|E3GU66_HAEI2 Haemophilus influenzae R2846
MFSLKRQQGASFEHQARLFLESKGLTFIAANQNFKCGELDLIMNDKETIVFVEVRQRSHS
AYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFGKTPQDIQWIPNFLD