HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GU50

Names and origin
Entry : E3GU50 (unreviewed)
Entry name : E3GU50_HAEI2
Protein names : Molybdopterin synthase, small subunit
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : moaD
ORF names : R2846_0721
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : Mo-molybdopterin cofactor biosynthetic process
GO identifier : GO:0006777
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 89 residues
>E3GU50|E3GU50_HAEI2 Haemophilus influenzae R2846
MLNVLFFAQTRELIGVDAIQLEDDFATADAVREYLAQKGDRWALALEKGKLLVAINQTLM
PLESAVKNGDEIAFFPPVTGG