HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GU49

Names and origin
Entry : E3GU49 (unreviewed)
Entry name : E3GU49_HAEI2
Protein names : Cyclic pyranopterin monophosphate synthase accessory protein (Molybdenum cofactor biosynthesis protein C)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : moaC
ORF names : R2846_0720
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Mo-molybdopterin cofactor biosynthetic process
GO identifier : GO:0006777
Keywords
Ligand & Biological process : Complete proteome; Molybdenum cofactor biosynthesis
General annotation
Pathway : Cofactor biosynthesis; molybdopterin biosynthesis.
Sequence similarities : Belongs to MoaC family
Protein sequence
Length : 172 residues
>E3GU49|E3GU49_HAEI2 Haemophilus influenzae R2846
MTTFTHINSQGEANMVDVSAKAETVREARAEAIVTMSKETLAMIVEGKHHKGDVFATARI
AGIQAAKRTWELIPLCHPLLLSKVEVNLEPLLETNQVRIQSLCKLTGKTGVEMEALTAAS
VAALTIYDMCKAVQKDIVIEQVRLLEKSGGKSSHFIAEEK