HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GU34

Names and origin
Entry : E3GU34 (unreviewed)
Entry name : E3GU34_HAEI2
Protein names : Electron transport complex protein RnfG
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rnfG
ORF names : R2846_0704
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : FMN binding; electron carrier activity; electron transport chain; integral to membrane; plasma membrane
GO identifier : GO:0010181; GO:0009055; GO:0022900; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Electron transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to RnfG family
Subcellular location : Cell inner membrane.
Protein sequence
Length : 223 residues
>E3GU34|E3GU34_HAEI2 Haemophilus influenzae R2846
MGTVKITSRYGILLGFIALLCTIISAGIYFLTKDKIDAVIAAQQRELLLQVIPQDYFNNN
LLESAVIPQDKNFVGIQKIYFAKKDGNISAYAYETTAPDGYSGDIRLLVGLDPKGEVLGV
RVIEHHETPGLGDKIERRISNWILGFTNQSINEHNLSEWSVKKDGGKFDQFSGATITPRA
VVNQTKRSALIMLNNQALLQQLSTQVK