HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GU33

Names and origin
Entry : E3GU33 (unreviewed)
Entry name : E3GU33_HAEI2
Protein names : Electron transport complex protein RnfE
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rnfE
ORF names : R2846_0703
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : electron transport chain; integral to membrane; oxidoreductase activity; plasma membrane
GO identifier : GO:0022900; GO:0016021; GO:0016491; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Electron transport; Membrane; Oxidoreductase; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to NqrDE/RnfAE family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 251 residues
>E3GU33|E3GU33_HAEI2 Haemophilus influenzae R2846
MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTAT
NALGLSLATMLVLTCTNTVISLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQ
SLGIFIPLIVTNCIIIGRAEAFASKNSLLHSIWDGFSMGLGMALSLTILGALREIIGQGT
IFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNVKK