HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GU29

Names and origin
Entry : E3GU29 (unreviewed)
Entry name : E3GU29_HAEI2
Protein names : Molybdenum ABC transporter, permease protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : modB
ORF names : R2846_0699
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; molybdate ion transmembrane transporter activity; plasma membrane
GO identifier : GO:0016021; GO:0015098; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to Binding-protein-dependent transport system permease family
Subcellular location : Membrane; Multi-pass membrane protein.
Protein sequence
Length : 245 residues
>E3GU29|E3GU29_HAEI2 Haemophilus influenzae R2846
MEISAINLSLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITGVIHLPLVLPPVVIGYL
LLVAMGRNGFIGKYLYQWFGLSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQA
AQTLGASAWRVFFTITLPLSLPGVLAGLVLGFARSLGEFGATITFVSNIAGETQTIPLAM
YSFIQTPAAEEQTARLCLFAIILSLISLLLSEWLSKRMQKKLGQGNVAN