HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTX9

Names and origin
Entry : E3GTX9 (unreviewed)
Entry name : E3GTX9_HAEI2
Protein names : Endoribonuclease YbeY (EC 3.1.-.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ybeY
ORF names : R2846_0643
EC number : 3.1.-.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; endoribonuclease activity; metalloendopeptidase activity; nucleic acid phosphodiester bond hydrolysis; rRNA processing; zinc ion binding
GO identifier : GO:0005737; GO:0004521; GO:0004222; GO:0090305; GO:0006364; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Metal-binding; Nuclease; Ribosome biogenesis; Zinc; rRNA processing
General annotation
Sequence similarities : Belongs to Endoribonuclease YbeY family
Subcellular location : Cytoplasm.
Protein sequence
Length : 166 residues
>E3GTX9|E3GTX9_HAEI2 Haemophilus influenzae R2846
MGSVLVDLQIATENIEGLPTEEQIVQWATGAVQPEGNEVEMTVRIVDEAESHELNLTYRG
KDRPTNVLSFPFECPDEVELPLLGDLVICRQVVEREAAEQEKPLMAHWAHMVVHGCLHLL
GYDHIEDDEAEEMESLETQIMQGLGFDDPYLAEK