HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTV9

Names and origin
Entry : E3GTV9 (unreviewed)
Entry name : E3GTV9_HAEI2
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : citD
ORF names : R2846_0623
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; lyase activity
GO identifier : GO:0005737; GO:0016829
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Lyase; Phosphoprotein
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Protein sequence
Length : 103 residues
>E3GTV9|E3GTV9_HAEI2 Haemophilus influenzae R2846
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKTAAMRATDETINWEAVL