HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTV5

Names and origin
Entry : E3GTV5 (unreviewed)
Entry name : E3GTV5_HAEI2
Protein names : UPF0250 protein R2846_0619
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ybeD
ORF names : R2846_0619
History
Date of creation : 2011-01-11
Date of modification : 2013-12-11
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0250 family
Protein sequence
Length : 100 residues
>E3GTV5|E3GTV5_HAEI2 Haemophilus influenzae R2846
MTIENDYAKLKELMEFPAKMTFKVAGINREGLAQDLIQVVQKYIKGDYIPKEKRSSKGTY
NSVSIDIIAENFDQVETLYKELAKVEGVKMVI