HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTS1

Names and origin
Entry : E3GTS1 (unreviewed)
Entry name : E3GTS1_HAEI2
Protein names : RNA polymerase-binding transcription factor DksA
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : dksA
ORF names : R2846_0584
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; regulation of gene expression; zinc ion binding
GO identifier : GO:0005737; GO:0010468; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Metal-binding; Zinc; Zinc-finger
General annotation
Domains : DksA C4-type zinc finger (1)
Sequence similarities : Belongs to DksA family
Subcellular location : Cytoplasm.
Protein sequence
Length : 157 residues
>E3GTS1|E3GTS1_HAEI2 Haemophilus influenzae R2846
MSRESLSLLDLAGVKPYQMKKDEEYMNEEQILHFRKILNAWHEQIVEEASRTVAHMQDEV
TNFPDPADRATQEEEFSLELRNRDRERKLMKKIEATLKKLDTDDFGYCDCCGEEIGIRRL
EARPTADLCIDCKTLAEIREKQVAG