HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GTQ1

Names and origin

Entry	:	E3GTQ1 (unreviewed)
Entry name	:	E3GTQ1_HAEI2
Protein names	:	Thioredoxin
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	trxM
ORF names	:	R2846_0563

History

Date of creation	:	2011-01-11
Date of modification	:	2013-12-11
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; glycerol ether metabolic process; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0006662; GO:0015035

Keywords

Ligand & Biological process

Complete proteome

General annotation

Domains	:	Thioredoxin domain (1)
Sequence similarities	:	Belongs to Thioredoxin family

Protein sequence

Length

115 residues

>E3GTQ1|E3GTQ1_HAEI2 Haemophilus influenzae R2846
MSEVLHINDADFESVVVNSNIPVLLDFWAPWCGPCKMIAPVLDELAPEFSGKVKIVKMNV
DDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALPKTQLANFINQHI