HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTI3

Names and origin
Entry : E3GTI3 (unreviewed)
Entry name : E3GTI3_HAEI2
Protein names : Acyl carrier protein (ACP)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : acpP
ORF names : R2846_0483
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process; cytoplasm
GO identifier : GO:0000036; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Fatty acid biosynthesis; Fatty acid metabolism; Lipid biosynthesis; Lipid metabolism; Phosphopantetheine
General annotation
Domains : Acyl carrier domain (1)
Pathway : Lipid metabolism; fatty acid biosynthesis.
Subcellular location : Cytoplasm.
Protein sequence
Length : 84 residues
>E3GTI3|E3GTI3_HAEI2 Haemophilus influenzae R2846
MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE
KITTVQSAIDYVQNNQ