HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTH9

Names and origin
Entry : E3GTH9 (unreviewed)
Entry name : E3GTH9_HAEI2
Protein names : 50S ribosomal protein L32
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL32
ORF names : rpmF
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L32P family
Protein sequence
Length : 60 residues
>E3GTH9|E3GTH9_HAEI2 Haemophilus influenzae R2846
MAVQQNKKSRSRRDMRRSHDALTTAAVSVDKASGETHLRHHVTADGYYRGRKVINK