HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTH4

Names and origin
Entry : E3GTH4 (unreviewed)
Entry name : E3GTH4_HAEI2
Protein names : Morphology-related protein BolA
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : bolA
ORF names : R2846_0474
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to BolA/yrbA family
Protein sequence
Length : 111 residues
>E3GTH4|E3GTH4_HAEI2 Haemophilus influenzae R2846
MSIQQIIEQKIQKEFQPHFLAIENESHLHHSNRGSESHFKCVIVSADFKNIRKVQRHQRI
YQLLNEELNHSIHALALHLFTPEEWKAQNETVPHSTKCAGIGR