HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTF2

Names and origin
Entry : E3GTF2 (unreviewed)
Entry name : E3GTF2_HAEI2
Protein names : Sec-independent protein translocase protein TatA
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : tatA
ORF names : R2846_0452
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : TAT protein transport complex; integral to plasma membrane; protein secretion; protein transmembrane transporter activity; protein transport by the Tat complex
GO identifier : GO:0033281; GO:0005887; GO:0009306; GO:0008320; GO:0043953
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to TatA/E family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Protein sequence
Length : 103 residues
>E3GTF2|E3GTF2_HAEI2 Haemophilus influenzae R2846
MAKKSIFRAKFFLFYRTEFIMFGLSPAQLIILLVVILLIFGTKKLRNAGSDLGAAVKGFK
KAMKEDEKVKDAEFKSIDNETASAKKENIKEKEQA